General Information

  • ID:  hor006106
  • Uniprot ID:  P04808
  • Protein name:  Relaxin A chain
  • Gene name:  RLN1
  • Organism:  Homo sapiens (Human)
  • Family:  Insulin family
  • Source:  Human
  • Expression:  Prostate. Not expressed in placenta, decidua or ovary.
  • Disease:  Diseases associated with RLN1 include Spermatogenic Failure 8 and Extragonadal Germ Cell Cancer.
  • Comments:  NA
  • Taxonomy:   Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0007165 signal transduction; GO:0007565 female pregnancy
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  PYVALFEKCCLIGCTKRSLAKYC
  • Length:  23(163-185)
  • Propeptide:  MPRLFLFHLLEFCLLLNQFSRAVAAKWKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALKDSNLSFEEFKKLIRNRQSEAADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRSLAKYC
  • Signal peptide:  MPRLFLFHLLEFCLLLNQFSRA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  RXFP2, RXFP1
  • Target Unid:   Q8WXD0, Q9HBX9
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45914
  • Structure ID:  AF-P04808-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006106_AF2.pdbhor006106_ESM.pdb

Physical Information

Mass: 300281 Formula: C117H189N29O30S4
Absent amino acids: DHMNQW Common amino acids: C
pI: 8.66 Basic residues: 4
Polar residues: 9 Hydrophobic residues: 8
Hydrophobicity: 46.52 Boman Index: -825
Half-Life / Aliphatic Index: >20 hour Aliphatic Index: 89.13
Instability Index: 6539.13 Extinction Coefficient cystines: 3230
Absorbance 280nm: 146.82

Literature

  • PubMed ID:  6548702
  • Title:  Relaxin gene expression in human ovaries and the predicted structure of a human preprorelaxin by analysis of cDNA clones.
  • PubMed ID:  6298628
  • Title:  Structure of a genomic clone encoding biologically active human relaxin.
  • PubMed ID:  15164053
  • Title:  DNA sequence and analysis of human chromosome 9.
  • PubMed ID:  15489334
  • Title:  The stat
  • PubMed ID:  8735594
  • Title:  
  • PubMed ID:  10601981
  • Title: